Mouse Anti-Frog scamp2 Antibody (MO-AB-07428H)


Cat: MO-AB-07428H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO07428C
SpecificityThis antibody binds to Frog scamp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants.
Product OverviewThis product is a mouse antibody against scamp2. It can be used for scamp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMGC84173 protein; scamp2; MGC84173
UniProt IDQ68EW8
Protein RefseqThe length of the protein is 327 amino acids long.
The sequence is show below: MSGYDTNPFADPVDVNPFQDPSVTQITTGNHGSLEEFNPFTEGSHLTNPNQKTIPAQSQPAVLQPSVDSTPQAAAMAAQTGLLQQQEELERKAAELDRKEQELRNVNINLRQNNWPPLPPKCPIKPCFYQDFSGDIPADYQRTCKMLYYLWMLHTFTLFLNLLACLSYFTAVPTGGVDFGLSILWFVMFTPCAFLCWYRPIYKAFRTDSSFSFFVFFIIFFCQIVIYIIQAVGIPGWGDSGWIMALTMIKSNVAVTVIMMVVASFFTVCSVFSLFLLKRVHSMYRRTGASFQRAQEEFSQGILANRNVQNAAAGAATAAARGAFQGN.
For Research Use Only | Not For Clinical Use.
Online Inquiry