Mouse Anti-Frog vbp1 Antibody (MO-AB-09022H)


Cat: MO-AB-09022H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO09022C
SpecificityThis antibody binds to Frog vbp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. The encoded protein functions as a chaperone protein, and may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. Alternative splicing and the use of alternate transcription start sites results in multiple transcript variants encoding different protein isoforms.
Product OverviewThis product is a mouse antibody against vbp1. It can be used for vbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesVbp1-prov protein; vbp1
UniProt IDQ7SYV4
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MAVTSEGAGGAGLKRTHLGIPEAGFVEDVEAFMKKAGNETADAVLKKLDEQYQKYKFMELNLTQKKRRLKNQIPEIKQTLEILKHMQKKKDTTEPMETRFMLADNLYCKASVPPTDKVCLWLGANVMLEYDIDDAQALLEKNLSTATRNLDSTEEDLDFLRDQFTTTEVNMARVYNWDVKRRNKDDPSKSKA.
For Research Use Only | Not For Clinical Use.
Online Inquiry