Mouse Anti-Fruit fly Acbp1 Antibody (MO-AB-02068W)
Cat: MO-AB-02068W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO02068W |
Specificity | This antibody binds to Fruit fly Acbp1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Binds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with arachidonyl-CoA, barely with oleoyl-CoA, but not with palmitoyl-CoA. Confers tolerance and binds to lead ions Pb, probably by promoting lead translocation from roots to shoots. May function as an intracellular carrier of acyl-CoA esters (By similarity). |
Product Overview | Mouse Anti-Fruit fly Acbp1 Antibody is a mouse antibody against Acbp1. It can be used for Acbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CG8498, isoform B; CG8498-PA; IP02950p; Acbp1 |
UniProt ID | Q9VLS4 |
Protein Refseq | The length of the protein is 90 amino acids long. The sequence is show below: MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKS. |
See other products for " ACBP1 "
CBMOAB-1412FYC | Mouse Anti-Arabidopsis ACBP1 Antibody (CBMOAB-1412FYC) |
CBMOAB-00228HCB | Mouse Anti-C. elegans ACBP1 Antibody (CBMOAB-00228HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry