Mouse Anti-Fruit fly Acbp1 Antibody (MO-AB-02068W)


Cat: MO-AB-02068W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO02068W
SpecificityThis antibody binds to Fruit fly Acbp1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBinds medium- and long-chain acyl-CoA esters with very high affinity. Can interact in vitro with arachidonyl-CoA, barely with oleoyl-CoA, but not with palmitoyl-CoA. Confers tolerance and binds to lead ions Pb, probably by promoting lead translocation from roots to shoots. May function as an intracellular carrier of acyl-CoA esters (By similarity).
Product OverviewMouse Anti-Fruit fly Acbp1 Antibody is a mouse antibody against Acbp1. It can be used for Acbp1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG8498, isoform B; CG8498-PA; IP02950p; Acbp1
UniProt IDQ9VLS4
Protein RefseqThe length of the protein is 90 amino acids long.
The sequence is show below: MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLDFKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKS.
For Research Use Only | Not For Clinical Use.
Online Inquiry