Mouse Anti-Fruit fly Acbp3 Antibody (MO-AB-02069W)
Cat: MO-AB-02069W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster) |
Clone | MO02069W |
Specificity | This antibody binds to Fruit fly Acbp3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | In Arabidopsis, there are six gene families (ACBP1 (AT5G53470), ACBP2 (AT4G27780), ACBP3 (AT4G24230), ACBP4 (AT3G05420), ACBP5 (AT5G27630), ACBP6 (AT1G3BPencodes)-binding protein). The expression of Arabidopsis ACBP3 is affected by light/dark cycles and is developmentally regulated in rosette leaves. |
Product Overview | Mouse Anti-Fruit fly Acbp3 Antibody is a mouse antibody against Acbp3. It can be used for Acbp3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CG8628, isoform B; CG8628-PA; Acbp3 |
UniProt ID | Q9VS22 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: MVSFEEATELANKFTKKPTDAEFLEFYGLFKQATVGDVNIEKPGALALKDKAKYEAWSSNKGLSKEAAKEAYVKVYEKYAPKYA. |
See other products for " ACBP3 "
CBMOAB-1414FYC | Mouse Anti-Arabidopsis ACBP3 Antibody (CBMOAB-1414FYC) |
MO-DKB-01987W | Rabbit Anti-ACBP3 Antibody (MO-DKB-01987W) |
CBMOAB-00229HCB | Mouse Anti-C. elegans ACBP3 Antibody (CBMOAB-00229HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry