Mouse Anti-Fruit fly Tat Antibody (MO-AB-03212W)


Cat: MO-AB-03212W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO03212W
SpecificityThis antibody binds to Fruit fly Tat.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis nuclear gene encodes a mitochondrial protein tyrosine aminotransferase which is present in the liver and catalyzes the conversion of L-tyrosine into p-hydroxyphenylpyruvate. Mutations in this gene cause tyrosinemia (type II, Richner-Hanhart syndrome), a disorder accompanied by major skin and corneal lesions, with possible cognitive disability. A regulator gene for tyrosine aminotransferase is X-linked.
Product OverviewMouse Anti-Fruit fly Tat Antibody is a mouse antibody against Tat. It can be used for Tat detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAlpha-tubulin N-acetyltransferase; Alpha-TAT; TAT; EC 2.3.1.108; Acetyltransferase mec-17 homolog; Tat
UniProt IDM9PEN1
Protein RefseqThe length of the protein is 291 amino acids long.
The sequence is show below: MVEFRFDIKPLFAQPIIKVTSNLLPNTFRGDRRQCLDATSKMTEIIDQLGQLSATSQGLSKPVTTAQRLRMSDNQTIYLLADNEAGHNGAVLGLLKVGTKNLYLFDEAGKTRMVEQTPSILDFYVHESRQRAGLGKRLFQTMLNEEQWTARKCSVDRPSEKLLSFLSKHYGLKRIIPQANNFVLYEGFFNDGESGNGGGNGHANGTPNGLHITNSPNTHLFGATYLGEDSNQRRGSQQQTTPNARLQQITQISPSGRYGAKRPTCSMAEIIHAGNSKGGNGNGSAEANRIK.
See other products for " TAT "
CBMOAB-44805FYCMouse Anti-Arabidopsis TAT Antibody (CBMOAB-44805FYC)
CBMOAB-08659FYBMouse Anti-Zebrafish tat Antibody (CBMOAB-08659FYB)
MO-AB-21284RMouse Anti-Cattle TAT Antibody (MO-AB-21284R)
For Research Use Only | Not For Clinical Use.
Online Inquiry