AibGenesis™ Mouse Anti-FSD1 Antibody (CBMOAB-33552FYC)
Cat: CBMOAB-33552FYC

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
- Reference
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-33552FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Maize (Zea mays), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) | WB, ELISA | MO33552FC | 100 µg | ||
| CBMOAB-43171FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43171FYA | 100 µg | ||
| CBMOAB-77004FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77004FYA | 100 µg | ||
| MO-AB-12711R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12711R | 100 µg | ||
| MO-AB-15908W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO15908W | 100 µg | ||
| MO-AB-25890H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25890C | 100 µg | ||
| MO-AB-48147W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO48147W | 100 µg | ||
| MO-AB-55682W | Monoclonal | Marmoset | WB, ELISA | MO55682W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Maize (Zea mays), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) |
| Clone | MO33552FC |
| Specificity | This antibody binds to Arabidopsis FSD1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Chloroplast; Plasma Membrane; Other locations; Mitochondrion |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a centrosome associated protein that is characterized by an N-terminal coiled-coil region downstream of B-box (BBC) domain, a central fibronectin type III domain, and a C-terminal repeats in splA and RyR (SPRY) domain. The encoded protein associates with a subset of microtubules and may be involved in the stability and organization of microtubules during cytokinesis. (From NCBI) |
| Product Overview | Mouse Anti-Arabidopsis FSD1 Antibody is a mouse antibody against FSD1. It can be used for FSD1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Fibronectin Type III And SPRY Domain Containing 1; Fibronectin Type 3 And SPRY Domain Containing 1; Microtubule-Associated Protein GLFND; MID1-Related Protein 1; GLFND; MIR1; Fibronectin Type 3 And SPRY (Spla, Ryanodine) Domain Containing (With Coiled-Coil Motif) 1; Fibronectin Type III And SPRY Domain-Containing Protein 1; Midline 1-Related Protein 1 |
| UniProt ID | P21276 |
| Protein Refseq | The length of the protein is 212 amino acids long. The sequence is show below: MAASSAVTANYVLKPPPFALDALEPHMSKQTLEFHWGKHHRAYVDNLKKQVLGTELEGKPLEHIIHSTYNNGDLLPAFNNAAQAWNHEFFWESMKPGGGGKPSGELLALLERDFTSYEKFYEEFNAAAATQFGAGWAWLAYSNEKLKVVKTPNAVNPLVLGSFPLLTIDVWEHAYYLDFQNRRPDYIKTFMTNLVSWEAVSARLEAAKAASA. |
Reference
| Reference | Garcia-Molina, A., Andrés-Colás, N., Perea-García, A., Neumann, U., Dodani, S. C., Huijser, P., ... & Puig, S. (2013). The Arabidopsis COPT6 transport protein functions in copper distribution under copper-deficient conditions. Plant and Cell Physiology, 54(8), 1378-1390. |
For Research Use Only | Not For Clinical Use.
Online Inquiry