Mouse Anti-ftsj1 Antibody (CBMOAB-77235FYA)
Cat: CBMOAB-77235FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-77235FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) | WB, ELISA | MO77235FYA | 100 µg | ||
MO-AB-00490L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00490L | 100 µg | ||
MO-AB-08139Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08139Y | 100 µg | ||
MO-AB-08526W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08526W | 100 µg | ||
MO-AB-12739R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12739R | 100 µg | ||
MO-AB-15315Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15315Y | 100 µg | ||
MO-AB-18289W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO18289W | 100 µg | ||
MO-AB-25944R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO25944R | 100 µg | ||
MO-AB-30844W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30844W | 100 µg | ||
MO-AB-34785W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34785W | 100 µg | ||
MO-AB-38559W | Monoclonal | Gorilla | WB, ELISA | MO38559W | 100 µg | ||
MO-AB-43152W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO43152W | 100 µg | ||
MO-AB-44805W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44805W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Gorilla, Hamsters (Cricetinae), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) |
Clone | MO77235FYA |
Specificity | This antibody binds to Zebrafish ftsj1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the methyltransferase superfamily. The encoded protein localizes to the nucleolus, binds to S-adenosylmethionine, and may be involved in the processing and modification of ribosomal RNA. Mutations in this gene are associated with cognitive disability. Alternative splicing results in multiple transcript variants. (From NCBI) |
Product Overview | Mouse Anti-Zebrafish ftsj1 Antibody is a mouse antibody against ftsj1. It can be used for ftsj1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase; EC 2.1.1.205; 2'-O-ribose RNA methyltransferase TRM7 homolog; ftsj |
UniProt ID | Q5U3P4 |
Protein Refseq | The length of the protein is 323 amino acids long. The sequence is show below: MGRSSKDKRDIYYRLAKEEGWRARSAFKLLQLDEEFKLFRGVSRAVDLCAAPGSWSQVLSRKLRGKDKSEEVKIVAVDLQAMAPLPGVTQIQGDITKISTAEEIIRHFEGESADLVVCDGAPDVTGLHDVDEYIQAQLLLAALNITTHVLKPGGNFVAKIFRGKDVTLLYSQLKIFFSFVTCAKPPSSRNSSIEAFVVCQNYSPPEGYVPNMSNPLLDHSYDVDFNQLEGPNRIIVPFLACGDLSGFDSDRTYPLQLDSSKEYQYLPPTQPPIRPPYQQACQLRKSNLLAKEDSPSGALDEALTALDLNTKPDTSTTTPGASE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry