Mouse Anti-FXYD7 Antibody (CBMOAB-43247FYA)
Cat: CBMOAB-43247FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-43247FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus) | WB, ELISA | MO43247FYA | 100 µg | ||
| MO-AB-00536R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00536R | 100 µg | ||
| MO-AB-12783R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO12783R | 100 µg | ||
| MO-AB-25915H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25915C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus) |
| Clone | MO43247FYA |
| Specificity | This antibody binds to Rhesus FXYD7. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Rhesus FXYD7 Antibody is a mouse antibody against FXYD7. It can be used for FXYD7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | FXYD domain-containing ion transport regulator 7; FXYD7 |
| UniProt ID | I2CY06 |
| Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV. |
For Research Use Only | Not For Clinical Use.
Online Inquiry