Mouse Anti-FXYD7 Antibody (CBMOAB-43247FYA)

Cat: CBMOAB-43247FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Product List
Specifications
Application Information
Target

Sub Cat	Clonality	Species Reactivity	Application	Clone	Conjugate	Size
CBMOAB-43247FYA	Monoclonal	Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus)	WB, ELISA	MO43247FYA		100 µg	Inquiry
Protein Refseq: The length of the protein is 80 amino acids long. The sequence is show below: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV.
MO-AB-00536R	Monoclonal	Medaka (Oryzias latipes)	WB, ELISA	MO00536R		100 µg	Inquiry
Protein Refseq: The length of the protein is 72 amino acids long. The sequence is show below: MATTEIMFPDQSDFEYDYETLRTTGVTLAVVLFVAGIFIALSKKIARCVKPSSKSNSNGTQIPKTEVPPPAV.
MO-AB-12783R	Monoclonal	Cattle (Bos taurus)	WB, ELISA	MO12783R		100 µg	Inquiry
Protein Refseq: The length of the protein is 78 amino acids long. The sequence is show below: MATQVPTKVPQDPDPFYYDYDTVQTVGMTLATILFLLGILIILSKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV.
MO-AB-25915H	Monoclonal	Rat (Rattus norvegicus)	WB, ELISA	MO25915C		100 µg	Inquiry
Protein Refseq: The length of the protein is 80 amino acids long. The sequence is show below: MATPTQSPTNVPEETDPFFYDYATVQTVGMTLATIMFVLGIIIIISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV.

Specifications

Host species	Mouse (Mus musculus)
Species Reactivity	Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus)
Clone	MO43247FYA
Specificity	This antibody binds to Rhesus FXYD7.
Format	Liquid or Lyophilized
Storage	Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use
Purity	> 90% was determined by SDS-PAGE
Purification	Purified with Protein A or G affinity chromatography

Application Information

Application	WB, ELISA
Application Notes	ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction	This reference sequence was derived from multiple replicate ESTs and validated by similar human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. This gene product, FXYD7, is novel and has not been characterized as a protein.
Product Overview	Mouse Anti-Rhesus FXYD7 Antibody is a mouse antibody against FXYD7. It can be used for FXYD7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names	FXYD domain-containing ion transport regulator 7; FXYD7
UniProt ID	I2CY06
Protein Refseq	The length of the protein is 80 amino acids long. The sequence is show below: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV.

For Research Use Only | Not For Clinical Use.

Online Inquiry