AibGenesis™ Mouse Anti-FXYD7 Antibody (CBMOAB-43247FYA)


Cat: CBMOAB-43247FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43247FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus) WB, ELISA MO43247FYA 100 µg
MO-AB-00536R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00536R 100 µg
MO-AB-12783R Monoclonal Cattle (Bos taurus) WB, ELISA MO12783R 100 µg
MO-AB-25915H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25915C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Medaka (Oryzias latipes), Rat (Rattus norvegicus)
CloneMO43247FYA
SpecificityThis antibody binds to Rhesus FXYD7.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus FXYD7 Antibody is a mouse antibody against FXYD7. It can be used for FXYD7 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFXYD domain-containing ion transport regulator 7; FXYD7
UniProt IDI2CY06
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: MATPTQTPTKAPEEPDPFYYDYNTVQTVGMTLATILFLLGILIVISKKVKCRKADSRSESPTCKSCKSELPSSAPGGGGV.
For Research Use Only | Not For Clinical Use.
Online Inquiry