AibGenesis™ Mouse Anti-Fz2 Antibody (CBMOAB-17108FYA)


Cat: CBMOAB-17108FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-17108FYA Monoclonal Fruit fly (Drosophila melanogaster), Chicken (Gallus gallus), D. melanogaster (Drosophila melanogaster) WB, ELISA MO17108FYA 100 µg
MO-AB-01963Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO01963Y 100 µg
MO-NAB-00604W Monoclonal D. melanogaster (Drosophila melanogaster) IHC, WB NW0526 100 µg
MO-NAB-00616W Monoclonal D. melanogaster (Drosophila melanogaster) IF, WB NW0538 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Chicken (Gallus gallus), D. melanogaster (Drosophila melanogaster)
CloneMO17108FYA
SpecificityThis antibody binds to fruit fly Fz2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionReceptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Required to coordinate the cytoskeletons of epidermal cells to produce a parallel array of cuticular hairs and bristles. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster Fz2 Antibody is a mouse antibody against Fz2. It can be used for Fz2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFrizzled 2, isoform F; fz2
UniProt IDM9PFW3
Protein RefseqThe length of the protein is 806 amino acids long.
The sequence is show below: MRHNRLKVLILGLVLLLTSCRADGPLHSADHGMGGMGMGGHGLDASPAPGYGVPVIPKDPNLRCEEITIPMCRGIGYNMTSFPNEMNHETQDEAGLEVHQFWPLVEIKCSPDLKFFLCSMYTPICLEDYHKPLPVCRSVCERARSGCAPIMQQYSFEWPERMACEHLPLHGDPDNLCMEQPSYTEAGSGGSSGGSGGSGSGSGSGGKRKQGGSGSGGSGAGGSSGSTSTKPCRGRNSKNCQNPQGEKASGKECSCSCRSPLIFLGKEQLLQQQSQMPMMHHPHHWYMNLTVQRIAGVPNCGIPCKGPFFSNDEKDFAGLWIALWSGLCFCSTLMTLTTFIIDTERFKYPERPIVFLSACYFMVAVGYLSRNFLQNEEIACDGLLLRESSTGPHSCTLVFLLTYFFGMASSIWWVILSFTWFLAAGLKWGNEAITKHSQYFHLAAWLIPTVQSVAVLLLSAVDGDPILGICYVGNLNPDHLKTFVLAPLFVYLVIGTTFLMAGFVSLFRIRSVIKQQGGVGAGVKADKLEKLMIRIGIFSVLYTVPATIVIGCYLYEAAYFEDWIKALACPCAQVKGPGKKPLYSVLMLKYFMALAVGITSGVWIWSGKTLESWRRFWRRLLGAPDRTGANQALIKQRPPIPHPYAGSGMGMPVGSAAGSLLATPYTQAGGASVASTSHHHLHHHVLKQPAASHVXHGESGGASTMGGGGGGGSTLGGGTLGHGTAMSSSTVGMGPLPGTLMHGASGGGVGGGNPGNVYGNGNNGVGGQNTAPGSVIDSRAVSVVVTLPGGPGAQHPGQALSDYGPI.
For Research Use Only | Not For Clinical Use.
Online Inquiry