Mouse Anti-GATA4 Antibody (CBMOAB-33749FYC)
Cat: CBMOAB-33749FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-33749FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Maize (Zea mays), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO33749FC | 100 µg | ||
CBMOAB-43398FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43398FYA | 100 µg | ||
CBMOAB-77585FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77585FYA | 100 µg | ||
MO-AB-26861W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26861W | 100 µg | ||
MO-AB-30907W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30907W | 100 µg | ||
MO-AB-48171W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO48171W | 100 µg | ||
MO-AB-03822H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03822C | 100 µg | ||
MO-AB-25954H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25954C | 100 µg | ||
MO-AB-02033Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02033Y | 100 µg | ||
MO-AB-15381Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15381Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Maize (Zea mays), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO33749FC |
Specificity | This antibody binds to Arabidopsis GATA4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Arabidopsis GATA4 Antibody is a mouse antibody against GATA4. It can be used for GATA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GATA Binding Protein 4; GATA-Binding Factor 4; Transcription Factor GATA-4; GATA-Binding Protein 4; TACHD; VSD1; ASD2; TOF |
UniProt ID | O49743 |
Protein Refseq | The length of the protein is 240 amino acids long. The sequence is show below: MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLLTDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAPSVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ. |
See other products for " GATA4 "
MO-AB-08177Y | Mouse Anti-GATA4 Antibody (MO-AB-08177Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry