Mouse Anti-GATA4 Antibody (CBMOAB-33749FYC)


Cat: CBMOAB-33749FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-33749FYC Monoclonal A. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Maize (Zea mays), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO33749FC 100 µg
CBMOAB-43398FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43398FYA 100 µg
CBMOAB-77585FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77585FYA 100 µg
MO-AB-26861W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26861W 100 µg
MO-AB-30907W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30907W 100 µg
MO-AB-48171W Monoclonal Maize (Zea mays) WB, ELISA MO48171W 100 µg
MO-AB-03822H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03822C 100 µg
MO-AB-25954H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25954C 100 µg
MO-AB-02033Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02033Y 100 µg
MO-AB-15381Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15381Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Maize (Zea mays), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO33749FC
SpecificityThis antibody binds to Arabidopsis GATA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the GATA family of zinc-finger transcription factors. Members of this family recognize the GATA motif which is present in the promoters of many genes. This protein is thought to regulate genes involved in embryogenesis and in myocardial differentiation and function, and is necessary for normal testicular development. Mutations in this gene have been associated with cardiac septal defects. Additionally, alterations in gene expression have been associated with several cancer types. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Arabidopsis GATA4 Antibody is a mouse antibody against GATA4. It can be used for GATA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGATA Binding Protein 4; GATA-Binding Factor 4; Transcription Factor GATA-4; GATA-Binding Protein 4; TACHD; VSD1; ASD2; TOF
UniProt IDO49743
Protein RefseqThe length of the protein is 240 amino acids long. The sequence is show below: MDVYGMSSPDLLRIDDLLDFSNDEIFSSSSTVTSSAASSAASSENPFSFPSSTYTSPTLLTDFTHDLCVPSDDAAHLEWLSRFVDDSFSDFPANPLTMTVRPEISFTGKPRSRRSRAPAPSVAGTWAPMSESELCHSVAKPKPKKVYNAESVTADGARRCTHCASEKTPQWRTGPLGPKTLCNACGVRYKSGRLVPEYRPASSPTFVLTQHSNSHRKVMELRRQKEQQESCVRIPPFQPQ.
See other products for " GATA4 "
For Research Use Only | Not For Clinical Use.
Online Inquiry