Mouse Anti-GCM1 Antibody (CBMOAB-43466FYA)


Cat: CBMOAB-43466FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43466FYA Monoclonal Rhesus (Macaca mulatta), Frog (Xenopus laevis) WB, ELISA MO43466FYA 100 µg
MO-AB-03848H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03848C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Frog (Xenopus laevis)
CloneMO43466FYA
SpecificityThis antibody binds to Rhesus GCM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a DNA-binding protein with a gcm-motif (glial cell missing motif). The encoded protein is a homolog of the Drosophila glial cells missing gene (gcm). This protein binds to the GCM-motif (A/G)CCCGCAT, a novel sequence among known targets of DNA-binding proteins. The N-terminal DNA-binding domain confers the unique DNA-binding activity of this protein. (From NCBI)
Product OverviewMouse Anti-Rhesus GCM1 Antibody is a mouse antibody against GCM1. It can be used for GCM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGCM1
UniProt IDF7HNY3
Protein RefseqThe length of the protein is 436 amino acids long.
The sequence is show below: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDKNAQRHLSSWAMRNTNNHNSRILKKSCLGVVVCGRDCLAEEGRKIYLRPAICDKARQKQQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEARRAMKKVHTAPSSVSLSLKGGTETRSLPGETQSQGSLPLTWSFQEGVQLPGSYSGHLIANTPQQNSLNDCFSFSKSYGLGGITDLTDQTSTVDPTKLYEKRKLSSSRTYSSGDLLPPSASGVYSDHGDLQTWSKNAALGRNHLNDNCYSNYPFPLTSWPCSFSPSQNSSEPFYQQIPLEPPAAKTGCPPLWPNPGGNLYEEKVHVDFNSYVQSPAYHSPQEDPFLFTYASHPHQQYSLPSKSSKWDFEEEMTYLGLDHCNSEMLLNLCPLR.
For Research Use Only | Not For Clinical Use.
Online Inquiry