AibGenesis™ Mouse Anti-GDAP1 Antibody (CBMOAB-43487FYA)


Cat: CBMOAB-43487FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43487FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Silkworm (Bombyx mori), Zebrafish (Danio rerio) WB, ELISA MO43487FYA 100 µg
CBMOAB-60849FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60849FYC 100 µg
CBMOAB-77714FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77714FYA 100 µg
MO-AB-02620W Monoclonal Fruit fly (Drosophila melanogaster) WB, ELISA MO02620W 100 µg
MO-AB-11836W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11836W 100 µg
MO-AB-12948R Monoclonal Cattle (Bos taurus) WB, ELISA MO12948R 100 µg
MO-AB-44848W Monoclonal Horse (Equus caballus) WB, ELISA MO44848W 100 µg
MO-AB-55923W Monoclonal Marmoset WB, ELISA MO55923W 100 µg
MO-AB-69864W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO69864W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Fruit fly (Drosophila melanogaster), Horse (Equus caballus), Marmoset, Silkworm (Bombyx mori), Zebrafish (Danio rerio)
CloneMO43487FYA
SpecificityThis antibody binds to Rhesus GDAP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Two transcript variants encoding different isoforms and a noncoding variant have been identified for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus GDAP1 Antibody is a mouse antibody against GDAP1. It can be used for GDAP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGDAP1
UniProt IDF6X699
Protein RefseqThe length of the protein is 358 amino acids long.
The sequence is show below: MAGRQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPLSEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKGSMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMVLAFRPRPNYF.
For Research Use Only | Not For Clinical Use.
Online Inquiry