Mouse Anti-GGACT Antibody (MO-AB-12738W)


Cat: MO-AB-12738W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-12738W Monoclonal Chimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO12738W 100 µg
MO-AB-12990R Monoclonal Cattle (Bos taurus) WB, ELISA MO12990R 100 µg
MO-AB-25987H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25987C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO12738W
SpecificityThis antibody binds to Chimpanzee GGACT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Chimpanzee GGACT Antibody is a mouse antibody against GGACT. It can be used for GGACT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAIG2-like domain 1; GGACT; A2LD1
UniProt IDH2RA08
Protein RefseqThe length of the protein is 153 amino acids long.
The sequence is show below: MALVFVYGTLKRGQPNHRVLRDCAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLPGSGRRVEGEVYAVDERMLRFLDDFESCPALYQRTVLRVQLLEDRAPGAEEPPAPTAVQCFVYSRATFPPEWAQLPHHDSYDSEGPHGLRYNPRENR.
For Research Use Only | Not For Clinical Use.
Online Inquiry