Mouse Anti-GHRL Antibody (CBMOAB-43582FYA)


Cat: CBMOAB-43582FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43582FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO43582FYA 100 µg
CBMOAB-77889FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77889FYA 100 µg
MO-AB-02104Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02104Y 100 µg
MO-AB-03894H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03894C 100 µg
MO-AB-08899W Monoclonal Cat (Felis catus) WB, ELISA MO08899W 100 µg
MO-AB-13037R Monoclonal Cattle (Bos taurus) WB, ELISA MO13037R 100 µg
MO-AB-15510Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15510Y 100 µg
MO-AB-25999H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO25999C 100 µg
MO-AB-26097R Monoclonal Pig (Sus scrofa) WB, ELISA MO26097R 100 µg
MO-AB-30932W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30932W 100 µg
MO-AB-37334W Monoclonal Goat (Capra hircus) WB, ELISA MO37334W 100 µg
MO-AB-55989W Monoclonal Marmoset WB, ELISA MO55989W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO43582FYA
SpecificityThis antibody binds to Rhesus GHRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression.
Product OverviewMouse Anti-Rhesus GHRL Antibody is a mouse antibody against GHRL. It can be used for GHRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGHRL
UniProt IDF7GMD4
Protein RefseqThe length of the protein is 117 amino acids long.
The sequence is show below: MPSPGNVCSLLLLGMLWLDLAMAGSSFLSPEHQRAQQRKESKKPPAKLQPRALGGWLRPEDGDQAEGVEDELEIQRPQLTSDCPQASLTSLFLPSLEALIWPFTCFCRNSHDCCTSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry