Mouse Anti-GHRL Antibody (CBMOAB-43582FYA)
Cat: CBMOAB-43582FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-43582FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO43582FYA | 100 µg | ||
CBMOAB-77889FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO77889FYA | 100 µg | ||
MO-AB-02104Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02104Y | 100 µg | ||
MO-AB-03894H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03894C | 100 µg | ||
MO-AB-08899W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08899W | 100 µg | ||
MO-AB-13037R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13037R | 100 µg | ||
MO-AB-15510Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15510Y | 100 µg | ||
MO-AB-25999H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO25999C | 100 µg | ||
MO-AB-26097R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26097R | 100 µg | ||
MO-AB-30932W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30932W | 100 µg | ||
MO-AB-37334W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37334W | 100 µg | ||
MO-AB-55989W | Monoclonal | Marmoset | WB, ELISA | MO55989W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Goat (Capra hircus), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO43582FYA |
Specificity | This antibody binds to Rhesus GHRL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes the ghrelin-obestatin preproprotein that is cleaved to yield two peptides, ghrelin and obestatin. Ghrelin is a powerful appetite stimulant and plays an important role in energy homeostasis. Its secretion is initiated when the stomach is empty, whereupon it binds to the growth hormone secretagogue receptor in the hypothalamus which results in the secretion of growth hormone (somatotropin). Ghrelin is thought to regulate multiple activities, including hunger, reward perception via the mesolimbic pathway, gastric acid secretion, gastrointestinal motility, and pancreatic glucose-stimulated insulin secretion. It was initially proposed that obestatin plays an opposing role to ghrelin by promoting satiety and thus decreasing food intake, but this action is still debated. Recent reports suggest multiple metabolic roles for obestatin, including regulating adipocyte function and glucose metabolism. Alternative splicing results in multiple transcript variants. In addition, antisense transcripts for this gene have been identified and may potentially regulate ghrelin-obestatin preproprotein expression. |
Product Overview | Mouse Anti-Rhesus GHRL Antibody is a mouse antibody against GHRL. It can be used for GHRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GHRL |
UniProt ID | F7GMD4 |
Protein Refseq | The length of the protein is 117 amino acids long. The sequence is show below: MPSPGNVCSLLLLGMLWLDLAMAGSSFLSPEHQRAQQRKESKKPPAKLQPRALGGWLRPEDGDQAEGVEDELEIQRPQLTSDCPQASLTSLFLPSLEALIWPFTCFCRNSHDCCTSS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry