AibGenesis™ Mouse Anti-GINS3 Antibody (CBMOAB-43601FYA)


Cat: CBMOAB-43601FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43601FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43601FYA 100 µg
CBMOAB-77923FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO77923FYA 100 µg
MO-AB-03898H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03898C 100 µg
MO-AB-13065R Monoclonal Cattle (Bos taurus) WB, ELISA MO13065R 100 µg
MO-AB-23491W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23491W 100 µg
MO-AB-26007H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26007C 100 µg
MO-AB-56009W Monoclonal Marmoset WB, ELISA MO56009W 100 µg
MO-DKB-01596W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Marmoset, Zebrafish (Danio rerio)
CloneMO43601FYA
SpecificityThis antibody binds to Rhesus GINS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein subunit of the GINS heterotetrameric complex, which is essential for the initiation of DNA replication and replisome progression in eukaryotes. Alternatively spliced transcript variants encoding distinct isoforms have been described. (From NCBI)
Product OverviewMouse Anti-Rhesus GINS3 Antibody is a mouse antibody against GINS3. It can be used for GINS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGINS3
UniProt IDF7EA40
Protein RefseqThe length of the protein is 218 amino acids long.
The sequence is show below: MSEAYFRVESGALGPEENFLSLDDILMSHEKLPVRTETAMPRLGAFFLERSAGAETDNAVPQGSKLELPLWLAKGLFDNKRRILSVELPKIYQEGWRTVFSADANVVDLHKMGPHFYGFGSQLLHFDSPENADISQSLLQAITFIGRFRRIMDSSQNAYNEDTSALVARLDEMERGLFQTGQKGLNDFQCWEKGQASQITASNLVQNYKKRKFTDMED.
For Research Use Only | Not For Clinical Use.
Online Inquiry