Mouse Anti-GLMN Antibody (CBMOAB-43671FYA)


Cat: CBMOAB-43671FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43671FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset WB, ELISA MO43671FYA 100 µg
MO-AB-03923H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03923C 100 µg
MO-AB-14256W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14256W 100 µg
MO-AB-44887W Monoclonal Horse (Equus caballus) WB, ELISA MO44887W 100 µg
MO-AB-56061W Monoclonal Marmoset WB, ELISA MO56061W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset
CloneMO43671FYA
SpecificityThis antibody binds to Rhesus GLMN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a phosphorylated protein that is a member of a Skp1-Cullin-F-box-like complex. The protein is essential for normal development of the vasculature and mutations in this gene have been associated with glomuvenous malformations, also called glomangiomas. Multiple splice variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus GLMN Antibody is a mouse antibody against GLMN. It can be used for GLMN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGLMN
UniProt IDF6ST95
Protein RefseqThe length of the protein is 594 amino acids long.
The sequence is show below: MAVEELQSIIKRCQILEEQDFKEEDFGLFQLAGQRCIEEGHIDQLLEIIQNEKNKVIIKNMGWNLIGPVVRCLLCKDKEDAKRKVCFLIFDLLVKLCNPKELLLGLLELIEEPSGKQISQSILLLLQPLQTVIQKLHNKAYSIGLALSTLWNQLSLLPVPYTKEQIQMDDYGLCQCCKALIEFTKPFVEEVIDNKENSLENEKLKDELLKFCFKSLKCPLLTAQFLEQSEEGGNDPFRYFASEIIGFLSAIGHPFPKMIFNHGRKKRTWNYLEFEEEEDKQLADSMASLAYLVFVQGIRIDQLPMVLSPLYLLQFNMGHIEVFLQRTEESVISKGLELLENSLLRIEDSSLLYQYLEIKSFLTVPQGLVKVMTLCPIETLRKKSLAMLQLYINKLDSQGKYTLFRCLLNTSNHSGVEAFIIQNIKNQIDMSLKRTHNNKWFTGPQLVSLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLVIKDNENDNQTGLWTELGNIENNFLKPLHIGLNMSKAHYEAEIKNSQEAQKSKDLCSITVGGEEIPNMPPEMQLKVLHSALFTFDLIESVLARVEELIEIKTKSTSEENIGIK.
For Research Use Only | Not For Clinical Use.
Online Inquiry