Mouse Anti-GLOD5 Antibody (CBMOAB-43675FYA)


Cat: CBMOAB-43675FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43675FYA Monoclonal Rhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO43675FYA 100 µg
CBMOAB-78004FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78004FYA 100 µg
MO-AB-26026H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26026C 100 µg
MO-AB-30962W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30962W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Dog (Canis lupus familiaris), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO43675FYA
SpecificityThis antibody binds to Rhesus GLOD5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein with a glyoxalase domain.
Product OverviewMouse Anti-Rhesus GLOD5 Antibody is a mouse antibody against GLOD5. It can be used for GLOD5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGLOD5
UniProt IDF6QJU8
Protein RefseqThe length of the protein is 138 amino acids long.
The sequence is show below: WRDSSQTPPPCLIHRLDHIVMTVKSIKDTTKFYSKILGMEVVTFKEDRKALCFGDQKFNLHEVGKEFEPKAAHPVPGSLDICLITEVPLEEMIQHLKACDVPIEEGPVPRTGAKGPIMSIYFRDPDRNLIEVSNYISS.
For Research Use Only | Not For Clinical Use.
Online Inquiry