Mouse Anti-GLT8D1 Antibody (CBMOAB-43696FYA)


Cat: CBMOAB-43696FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43696FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Mouse (Mus musculus), Rat (Rattus norvegicus), Human (Homo sapiens), Bovine (Bos taurus), Zebrafish (Danio rerio) WB, ELISA MO43696FYA 100 µg
CBMOAB-78051FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78051FYA 100 µg
MO-AB-13125R Monoclonal Cattle (Bos taurus) WB, ELISA MO13125R 100 µg
MO-AB-23653W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23653W 100 µg
MO-AB-56079W Monoclonal Marmoset WB, ELISA MO56079W 100 µg
MO-DKB-01462W Polyclonal Mouse (Mus musculus), Rat (Rattus norvegicus), Human (Homo sapiens), Bovine (Bos taurus), Rhesus (Macaca mulatta) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Mouse (Mus musculus), Rat (Rattus norvegicus), Human (Homo sapiens), Bovine (Bos taurus), Zebrafish (Danio rerio)
CloneMO43696FYA
SpecificityThis antibody binds to Rhesus GLT8D1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the glycosyltransferase family. The specific function of this protein has not been determined. Alternative splicing results in multiple transcript variants of this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus GLT8D1 Antibody is a mouse antibody against GLT8D1. It can be used for GLT8D1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGLT8D1
UniProt IDF7HND4
Protein RefseqThe length of the protein is 224 amino acids long.
The sequence is show below: MDDDVIVQGDILALYNTPLKPGHAAAFSEDCDSASTKVVIRGAGNQYNYIGYLDYKKERIRKLSMKASTCSFNPGVFVANLTEWKRQNITNQLEKWMKLNVEEGLYSRTLAGSITTPPLLIVFYQQHSTIDPMWNPPPWFQCWKTIFTSVCKGCQITHWNGHFKPWGRTASYTCLGKMVYSRPNRQIQPNPKIYRDLKHKVKQNLNYAFLRKSWKMACMQSNSC.
For Research Use Only | Not For Clinical Use.
Online Inquiry