Mouse Anti-GMDS Antibody (CBMOAB-43732FYA)


Cat: CBMOAB-43732FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43732FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43732FYA 100 µg
CBMOAB-78095FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78095FYA 100 µg
MO-AB-03937H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03937C 100 µg
MO-AB-12334W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12334W 100 µg
MO-AB-13140R Monoclonal Cattle (Bos taurus) WB, ELISA MO13140R 100 µg
MO-AB-43179W Monoclonal Hamsters (Cricetinae) WB, ELISA MO43179W 100 µg
MO-AB-56090W Monoclonal Marmoset WB, ELISA MO56090W 100 µg
MO-DKB-01084W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Rhesus (Macaca mulatta), Frog (Xenopus) WB, IHC, IHC-P 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Hamsters (Cricetinae), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Frog (Xenopus), Marmoset, Zebrafish (Danio rerio)
CloneMO43732FYA
SpecificityThis antibody binds to Rhesus GMDS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGDP-mannose 4,6-dehydratase (GMD; EC 4.2.1.47) catalyzes the conversion of GDP-mannose to GDP-4-keto-6-deoxymannose, the first step in the synthesis of GDP-fucose from GDP-mannose, using NADP+ as a cofactor. The second and third steps of the pathway are catalyzed by a single enzyme, GDP-keto-6-deoxymannose 3,5-epimerase, 4-reductase, designated FX in humans (MIM 137020).
Product OverviewMouse Anti-Rhesus GMDS Antibody is a mouse antibody against GMDS. It can be used for GMDS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGMDS
UniProt IDF7GZ39
Protein RefseqThe length of the protein is 339 amino acids long.
The sequence is show below: MDGSYLAEFLLEKGYEVHGIVRRSSSFNTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDLAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSLGNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFMHIGKTIVWEGKNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVHADVELMRTNPNA.
For Research Use Only | Not For Clinical Use.
Online Inquiry