Mouse Anti-Gmfg Antibody (MO-AB-26041H)


Cat: MO-AB-26041H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-26041H Monoclonal Rat (Rattus norvegicus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO26041C 100 µg
CBMOAB-43740FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO43740FYA 100 µg
CBMOAB-78105FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78105FYA 100 µg
MO-AB-23451W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23451W 100 µg
MO-AB-56095W Monoclonal Marmoset WB, ELISA MO56095W 100 µg
MO-AB-03941H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03941C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO26041C
SpecificityThis antibody binds to Rat Gmfg.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewThis product is a mouse antibody against Gmfg. It can be used for Gmfg detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlia maturation factor gamma; GMF-gamma; Gmfg
UniProt IDQ80T18
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MSDSLVVCDVDPELKETLRKFRFRKETNNAAIIMKVDKDRQMVVLEDEFQNVSPEELKLELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQIAELTKVFEIRTTDDLNETWLKEKLAFFR.
See other products for " GMFG "
For Research Use Only | Not For Clinical Use.
Online Inquiry