Mouse Anti-GML Antibody (MO-AB-13146R)


Cat: MO-AB-13146R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13146R Monoclonal Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO13146R 100 µg
MO-AB-26043H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26043C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO13146R
SpecificityThis antibody binds to Cattle GML.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cattle GML Antibody is a mouse antibody against GML. It can be used for GML detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlycosylphosphatidylinositol anchored molecule like protein; GML
UniProt IDQ32P93
Protein RefseqThe length of the protein is 154 amino acids long.
The sequence is show below: MLLFAFLLFMGLPLGFVEPWTFNVQCHECIVKNTFHCPVKRTCPYDIRRCFTVSMRLNSREILVYKNCTFNCTFLYRAEEPPETPRRKTTHRFNSFYWVHCCGSNMCNFGGPTNLERDITLDYPLEEDIEGNAQLVQSTVFLSIVSILVRNTLT.
For Research Use Only | Not For Clinical Use.
Online Inquiry