AibGenesis™ Mouse Anti-GMPR2 Antibody (CBMOAB-43749FYA)
Cat: CBMOAB-43749FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-43749FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO43749FYA | 100 µg | ||
| CBMOAB-78120FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78120FYA | 100 µg | ||
| MO-AB-00554L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00554L | 100 µg | ||
| MO-AB-03945H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03945C | 100 µg | ||
| MO-AB-08225Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08225Y | 100 µg | ||
| MO-AB-08852W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08852W | 100 µg | ||
| MO-AB-13153R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13153R | 100 µg | ||
| MO-AB-15544Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15544Y | 100 µg | ||
| MO-AB-25653W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO25653W | 100 µg | ||
| MO-AB-26128R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26128R | 100 µg | ||
| MO-AB-30967W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30967W | 100 µg | ||
| MO-AB-34842W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34842W | 100 µg | ||
| MO-AB-44897W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44897W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO43749FYA |
| Specificity | This antibody binds to Rhesus GMPR2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus GMPR2 Antibody is a mouse antibody against GMPR2. It can be used for GMPR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | GMP reductase; EC 1.7.1.7; GMPR2 |
| UniProt ID | I2CUP4 |
| Protein Refseq | The length of the protein is 366 amino acids long. The sequence is show below: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYTGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLEEWQEFAGQNPDCLEHLAASSGTGASDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEVC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry