AibGenesis™ Mouse Anti-GMPR2 Antibody (CBMOAB-43749FYA)


Cat: CBMOAB-43749FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43749FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO43749FYA 100 µg
CBMOAB-78120FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78120FYA 100 µg
MO-AB-00554L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00554L 100 µg
MO-AB-03945H Monoclonal Frog (Xenopus laevis) WB, ELISA MO03945C 100 µg
MO-AB-08225Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08225Y 100 µg
MO-AB-08852W Monoclonal Cat (Felis catus) WB, ELISA MO08852W 100 µg
MO-AB-13153R Monoclonal Cattle (Bos taurus) WB, ELISA MO13153R 100 µg
MO-AB-15544Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15544Y 100 µg
MO-AB-25653W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO25653W 100 µg
MO-AB-26128R Monoclonal Pig (Sus scrofa) WB, ELISA MO26128R 100 µg
MO-AB-30967W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO30967W 100 µg
MO-AB-34842W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34842W 100 µg
MO-AB-44897W Monoclonal Horse (Equus caballus) WB, ELISA MO44897W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO43749FYA
SpecificityThis antibody binds to Rhesus GMPR2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme that catalyzes the irreversible and NADPH-dependent reductive deamination of guanosine monophosphate (GMP) to inosine monophosphate (IMP). The protein also functions in the re-utilization of free intracellular bases and purine nucleosides. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus GMPR2 Antibody is a mouse antibody against GMPR2. It can be used for GMPR2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGMP reductase; EC 1.7.1.7; GMPR2
UniProt IDI2CUP4
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MTSCLPALRFIATPRLSAMPHIDNDVKLDFKDVLLRPKRSTLKSRSEVDLTRSFSFRNSKQTYTGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLEEWQEFAGQNPDCLEHLAASSGTGASDFEQLEQILEAIPQVKYICLDVANGYSEHFVEFVKDVRKRFPQHTIMAGNVVTGEMVEELILSGADIIKVGIGPGSVCTTRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESGGELIERDGKKYKLFYGMSSEMAMKKYAGGVAEYRASEGKTVEVPFKGDVEHTIRDILGGIRSTCTYVGAAKLKELSRRTTFIRVTQQVNPIFSEVC.
For Research Use Only | Not For Clinical Use.
Online Inquiry