AibGenesis™ Mouse Anti-GNB1L Antibody (CBMOAB-43764FYA)


Cat: CBMOAB-43764FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43764FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO43764FYA 100 µg
CBMOAB-78174FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78174FYA 100 µg
MO-AB-10852W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10852W 100 µg
MO-AB-56125W Monoclonal Marmoset WB, ELISA MO56125W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO43764FYA
SpecificityThis antibody binds to Rhesus GNB1L.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a G-protein beta-subunit-like polypeptide which is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 6 WD repeats and is highly expressed in the heart. The gene maps to the region on chromosome 22q11, which is deleted in DiGeorge syndrome, trisomic in derivative 22 syndrome and tetrasomic in cat-eye syndrome. Therefore, this gene may contribute to the etiology of those disorders. Transcripts from this gene share exons with some transcripts from the C22orf29 gene. (From NCBI)
Product OverviewMouse Anti-Rhesus GNB1L Antibody is a mouse antibody against GNB1L. It can be used for GNB1L detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGuanine nucleotide-binding protein subunit beta-like protein 1; GNB1L
UniProt IDH9FDN5
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: VTWLQMLPQGHQLLSQGRDLKLCLWDLAEGRNAVVDSVRLESVGFCRSSILAGGQPRWMLAVPGKGGDEVQILEMPSKTSVCALKPKADAKLGMPMCLRLWQADCNPRPLLLAGYEDGSVALWDVSEQKVCSHIACHEEPVMDLDFDSQKARGISGSAGKALAVWSLDGQQALQVRGTHELTNPGIAEITIRPDRKILATAGWDHRIRVFHWRTMQPLA.
For Research Use Only | Not For Clinical Use.
Online Inquiry