Mouse Anti-GNG5 Antibody (MO-AB-00561L)
Cat: MO-AB-00561L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-00561L | Monoclonal | Elephant (Loxodonta africana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO00561L | 100 µg | ||
| CBMOAB-43775FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO43775FYA | 100 µg | ||
| CBMOAB-78196FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78196FYA | 100 µg | ||
| MO-AB-22997W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22997W | 100 µg | ||
| MO-AB-30986W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO30986W | 100 µg | ||
| MO-AB-56139W | Monoclonal | Marmoset | WB, ELISA | MO56139W | 100 µg | ||
| MO-AB-13181R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13181R | 100 µg | ||
| MO-AB-03968H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO03968C | 100 µg | ||
| MO-AB-26061H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26061C | 100 µg | ||
| MO-AB-02165Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02165Y | 100 µg | ||
| MO-AB-06523Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06523Y | 100 µg | ||
| MO-AB-15562Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15562Y | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Elephant (Loxodonta africana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO00561L |
| Specificity | This antibody binds to Elephant GNG5. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Plasma membrane |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction. (From uniprot, under CC BY 4.0) |
| Product Overview | This product is a mouse antibody against GNG5. It can be used for GNG5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | G Protein Subunit Gamma 5; Guanine Nucleotide Binding Protein (G Protein), Gamma 5; GNGT5 |
| UniProt ID | G3SZC1 |
| Protein Refseq | The length of the protein is 68 amino acids long. The sequence is show below: MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFRPQKVCSFL. |
For Research Use Only | Not For Clinical Use.
Online Inquiry