Mouse Anti-GNLY Antibody (CBMOAB-43782FYA)


Cat: CBMOAB-43782FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43782FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Pig (Sus scrofa), Sheep (Ovis aries) WB, ELISA MO43782FYA 100 µg
MO-AB-02167Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02167Y 100 µg
MO-AB-13191R Monoclonal Cattle (Bos taurus) WB, ELISA MO13191R 100 µg
MO-AB-14212W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14212W 100 µg
MO-AB-15567Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15567Y 100 µg
MO-AB-26160R Monoclonal Pig (Sus scrofa) WB, ELISA MO26160R 100 µg
MO-AB-44908W Monoclonal Horse (Equus caballus) WB, ELISA MO44908W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Horse (Equus caballus), Pig (Sus scrofa), Sheep (Ovis aries)
CloneMO43782FYA
SpecificityThis antibody binds to Rhesus GNLY.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified.
Product OverviewMouse Anti-Rhesus GNLY Antibody is a mouse antibody against GNLY. It can be used for GNLY detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGranulysin isoform NKG5; GNLY
UniProt IDH9YYG7
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MVTWALLLLAAMLLGNPGLVFSRLSPEYYEVATAHLCDKEQSCPCLAQEGPQGDLLIKMQELGFDCKICLRIIQTLKAMVNEPTQRSISNAEARVCRMVKSQWRDVCKNFMRRYQPRVTQGLLAGETAQKICVDLRLCEPSMGSL.
For Research Use Only | Not For Clinical Use.
Online Inquiry