Mouse Anti-Goat ATRN Antibody (MO-AB-36747W)
Cat: MO-AB-36747W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Goat (Capra hircus) |
Clone | MO36747W |
Specificity | This antibody binds to Goat ATRN. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes both membrane-bound and secreted protein isoforms. A membrane-bound isoform exhibits sequence similarity with the mouse mahogany protein, a receptor involved in controlling obesity. A secreted isoform is involved in the initial immune cell clustering during inflammatory responses that may regulate the chemotactic activity of chemokines. |
Product Overview | Mouse Anti-Goat ATRN Antibody is a mouse antibody against ATRN. It can be used for ATRN detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Attractin; ATRN |
UniProt ID | B5KLN8 |
Protein Refseq | The length of the protein is 60 amino acids long. The sequence is show below: KNTWSILHTQGALVQGGYGHSSVYDDRTKALYIHGGYKAFSANKYRLADDLYRYDVDTQM. |
See other products for " atrn "
MO-AB-22985H | Mouse Anti-Mallard atrn Antibody (MO-AB-22985H) |
MO-AB-24035R | Mouse Anti-Pig ATRN Antibody (MO-AB-24035R) |
MO-AB-25860W | Mouse Anti-Chimpanzee ATRN Antibody (MO-AB-25860W) |
MO-AB-51625W | Mouse Anti-Marmoset ATRN Antibody (MO-AB-51625W) |
CBMOAB-36622FYA | Mouse Anti-Rhesus ATRN Antibody (CBMOAB-36622FYA) |
MO-AB-07886R | Mouse Anti-Cattle ATRN Antibody (MO-AB-07886R) |
CBMOAB-63806FYA | Mouse Anti-Zebrafish atrn Antibody (CBMOAB-63806FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry