Mouse Anti-Goat Hesx1 Antibody (MO-AB-37409W)
Cat: MO-AB-37409W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Goat (Capra hircus) |
Clone | MO37409W |
Specificity | This antibody binds to Goat Hesx1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. |
Product Overview | Mouse Anti-Goat Hesx1 Antibody is a mouse antibody against Hesx1. It can be used for Hesx1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Homeobox transcription factor Hesx1; Hesx1 |
UniProt ID | F2Q6J0 |
Protein Refseq | The length of the protein is 66 amino acids long. The sequence is show below: KEVNLCLHVPTLPSGISLPQTVDHSVPEESVWKYEDYFAPSERLSLKRELSWYRGRRPRTAFTQNQ. |
See other products for " hesx1 "
CBMOAB-79378FYA | Mouse Anti-Zebrafish hesx1 Antibody (CBMOAB-79378FYA) |
MO-AB-08342Y | Mouse Anti-Rabbit HESX1 Antibody (MO-AB-08342Y) |
MO-AB-13635R | Mouse Anti-Cattle HESX1 Antibody (MO-AB-13635R) |
CBMOAB-44497FYA | Mouse Anti-Rhesus HESX1 Antibody (CBMOAB-44497FYA) |
MO-AB-26280H | Mouse Anti-Rat Hesx1 Antibody (MO-AB-26280H) |
MO-AB-56695W | Mouse Anti-Marmoset HESX1 Antibody (MO-AB-56695W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry