Mouse Anti-GPIHBP1 Antibody (CBMOAB-43903FYA)


Cat: CBMOAB-43903FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-43903FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus) WB, ELISA MO43903FYA 100 µg
MO-AB-13261R Monoclonal Cattle (Bos taurus) WB, ELISA MO13261R 100 µg
MO-AB-26089H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26089C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Rat (Rattus norvegicus)
CloneMO43903FYA
SpecificityThis antibody binds to Rhesus GPIHBP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a capillary endothelial cell protein that facilitates the lipolytic processing of triglyceride-rich lipoproteins. The encoded protein is a glycosylphosphatidylinositol-anchored protein that is a member of the lymphocyte antigen 6 (Ly6) family. This protein plays a major role in transporting lipoprotein lipase (LPL) from the subendothelial spaces to the capillary lumen. Mutations in this gene are the cause of hyperlipoproteinemia, type 1D. Alternate splicing results in multiple transcript variants.
Product OverviewMouse Anti-Rhesus GPIHBP1 Antibody is a mouse antibody against GPIHBP1. It can be used for GPIHBP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPIHBP1
UniProt IDF7HE29
Protein RefseqThe length of the protein is 183 amino acids long.
The sequence is show below: MKVLRALLLALLLCGQPGAGQRVTLREPQEELRKKEGMRPESPAQSGVDTNRLPGGRGRVLLWCYTCQSLSRDEHCNLTRSCSHGQACTTLIAHGNTESGLLTTHSAWCTDNCQPITKTVEGTQVTTTCCQFNLCNVPPWQSSRVQDPPGKGAGGPRGSCETAGTALLLNLLAGLGAMGAGRP.
For Research Use Only | Not For Clinical Use.
Online Inquiry