Mouse Anti-GPR33 Antibody (CBMOAB-44012FYA)


Cat: CBMOAB-44012FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44012FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO44012FYA 100 µg
MO-AB-26202R Monoclonal Pig (Sus scrofa) WB, ELISA MO26202R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO44012FYA
SpecificityThis antibody binds to Rhesus GPR33.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene has been identified as an orphan chemoattractant G-protein-coupled receptors (GPCR) pseudogene. Studies have shown that the inactivated gene is present as the predominant allele in the human population. A small fraction of the human population has been found to harbor an intact allele. (From NCBI)
Product OverviewMouse Anti-Rhesus GPR33 Antibody is a mouse antibody against GPR33. It can be used for GPR33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR33
UniProt IDF6SMH9
Protein RefseqThe length of the protein is 302 amino acids long.
The sequence is show below: MDLINSTDYLINASTLVRNSTQFLAPASKMIIALSLYISSIIGTITNGLYLWVLRFKMKQTVNTLLYFHLIFSYFISTLILPFMATSQLQDNHWNFGTALCKVFNGTLSLGMFTSVFFLSAISLDRYLLTLHPVSQQHRTPRWASGIVLRVWISAAALSIPKEMQALRQWIHVACLTRFFLGFLLPFFITLICYERVASKVKERGLFKSSKPFKVMMTAIVSFFVCWMPYHIHQGLLLTKNQSLLLELTLILTVLTTSFNTIFSPTLYLFTGENFKNVFKKSILALFESTFSEDSSAERTQN.
For Research Use Only | Not For Clinical Use.
Online Inquiry