Mouse Anti-GPR55 Antibody (CBMOAB-44025FYA)


Cat: CBMOAB-44025FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44025FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44025FYA 100 µg
MO-AB-03739W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO03739W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO44025FYA
SpecificityThis antibody binds to Rhesus GPR55.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction pathways.
Product OverviewMouse Anti-Rhesus GPR55 Antibody is a mouse antibody against GPR55. It can be used for GPR55 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGPR55
UniProt IDF6RRJ0
Protein RefseqThe length of the protein is 271 amino acids long.
The sequence is show below: XKNRWPDYAATSIYMINLAVFDLLLVLSLPFKMSLSQVQSPYPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVNHLRSPRKIFGICCTIWVLVWTGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCSSRSIHILLGRRDHTQDWVQQRACIYSIAVSLAVFVVSFLPVHLGFFLQFLVRNGFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry