Mouse Anti-GPX3 Antibody (CBMOAB-34190FYC)


Cat: CBMOAB-34190FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34190FYC Monoclonal A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO34190FC 100 µg
CBMOAB-44071FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44071FYA 100 µg
CBMOAB-78576FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78576FYA 100 µg
CBMOAB-04657HCB Monoclonal C. elegans (Caenorhabditis elegans) WB, ELISA MO04657HB 100 µg
MO-AB-08054W Monoclonal Cat (Felis catus) WB, ELISA MO08054W 100 µg
MO-AB-13384W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13384W 100 µg
MO-AB-31015W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31015W 100 µg
MO-AB-34858W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34858W 100 µg
MO-AB-41766W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41766W 100 µg
MO-AB-44935W Monoclonal Horse (Equus caballus) WB, ELISA MO44935W 100 µg
MO-AB-56325W Monoclonal Marmoset WB, ELISA MO56325W 100 µg
MO-AB-13332R Monoclonal Cattle (Bos taurus) WB, ELISA MO13332R 100 µg
MO-AB-26221R Monoclonal Pig (Sus scrofa) WB, ELISA MO26221R 100 µg
MO-AB-04044H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04044C 100 µg
MO-AB-23267H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO23267C 100 µg
MO-AB-26102H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26102C 100 µg
MO-AB-00581L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00581L 100 µg
MO-AB-02215Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02215Y 100 µg
MO-AB-15583Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15583Y 100 µg
MO-DKB-01997W Polyclonal A. thaliana (Arabidopsis thaliana) WB 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO34190FC
SpecificityThis antibody binds to Arabidopsis GPX3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Golgi apparatus; Cytosol; Endoplasmic reticulum; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Arabidopsis GPX3 Antibody is a mouse antibody against GPX3. It can be used for GPX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione Peroxidase 3; Extracellular Glutathione Peroxidase; Glutathione Peroxidase 3 (Plasma); Plasma Glutathione Peroxidase; EC 1.11.1.9; GSHPx-3
UniProt IDO22850
Protein RefseqThe length of the protein is 206 amino acids long. The sequence is show below: MPRSSRWVNQRATSKIKKFILFLGVAFVFYLYRYPSSPSTVEQSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLLASA.
See other products for " GPX3 "
For Research Use Only | Not For Clinical Use.
Online Inquiry