Mouse Anti-GPX3 Antibody (CBMOAB-34190FYC)
Cat: CBMOAB-34190FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-34190FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO34190FC | 100 µg | ||
CBMOAB-44071FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44071FYA | 100 µg | ||
CBMOAB-78576FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78576FYA | 100 µg | ||
CBMOAB-04657HCB | Monoclonal | C. elegans (Caenorhabditis elegans) | WB, ELISA | MO04657HB | 100 µg | ||
MO-AB-08054W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08054W | 100 µg | ||
MO-AB-13384W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13384W | 100 µg | ||
MO-AB-31015W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31015W | 100 µg | ||
MO-AB-34858W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34858W | 100 µg | ||
MO-AB-41766W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41766W | 100 µg | ||
MO-AB-44935W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO44935W | 100 µg | ||
MO-AB-56325W | Monoclonal | Marmoset | WB, ELISA | MO56325W | 100 µg | ||
MO-AB-13332R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13332R | 100 µg | ||
MO-AB-26221R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26221R | 100 µg | ||
MO-AB-04044H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04044C | 100 µg | ||
MO-AB-23267H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23267C | 100 µg | ||
MO-AB-26102H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26102C | 100 µg | ||
MO-AB-00581L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00581L | 100 µg | ||
MO-AB-02215Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02215Y | 100 µg | ||
MO-AB-15583Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15583Y | 100 µg | ||
MO-DKB-01997W | Polyclonal | A. thaliana (Arabidopsis thaliana) | WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), C. elegans (Caenorhabditis elegans), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Mallard (Anas platyrhynchos), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO34190FC |
Specificity | This antibody binds to Arabidopsis GPX3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endosome; Golgi apparatus; Cytosol; Endoplasmic reticulum; Mitochondrion |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene belongs to the glutathione peroxidase family, members of which catalyze the reduction of organic hydroperoxides and hydrogen peroxide (H2O2) by glutathione, and thereby protect cells against oxidative damage. Several isozymes of this gene family exist in vertebrates, which vary in cellular location and substrate specificity. This isozyme is secreted, and is abundantly found in plasma. Downregulation of expression of this gene by promoter hypermethylation has been observed in a wide spectrum of human malignancies, including thyroid cancer, hepatocellular carcinoma and chronic myeloid leukemia. This isozyme is also a selenoprotein, containing the rare amino acid selenocysteine (Sec) at its active site. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. Alternatively spliced transcript variants have been found for this gene. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis GPX3 Antibody is a mouse antibody against GPX3. It can be used for GPX3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Glutathione Peroxidase 3; Extracellular Glutathione Peroxidase; Glutathione Peroxidase 3 (Plasma); Plasma Glutathione Peroxidase; EC 1.11.1.9; GSHPx-3 |
UniProt ID | O22850 |
Protein Refseq | The length of the protein is 206 amino acids long. The sequence is show below: MPRSSRWVNQRATSKIKKFILFLGVAFVFYLYRYPSSPSTVEQSSTSIYNISVKDIEGKDVSLSKFTGKVLLIVNVASKCGLTHGNYKEMNILYAKYKTQGFEILAFPCNQFGSQEPGSNMEIKETVCNIFKAEFPIFDKIEVNGKNTCPLYNFLKEQKGGLFGDAIKWNFAKFLVDRQGNVVDRYAPTTSPLEIEKDIVKLLASA. |
See other products for " GPX3 "
MO-DKB-01998W | Rabbit Anti-GPX3 Antibody (MO-DKB-01998W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry