Mouse Anti-Grape act1 Antibody (MO-AB-38815W)


Cat: MO-AB-38815W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO38815W
SpecificityThis antibody binds to Grape act1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the reproductive actins.
Product OverviewMouse Anti-Grape act1 Antibody is a mouse antibody against act1. It can be used for act1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin 1; act1
UniProt IDQ94KC1
Protein RefseqThe length of the protein is180 amino acids long.
The sequence is show below: TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIG.
See other products for " ACT1 "
CBMOAB-00212FYAMouse Anti-Alpaca ACT1 Antibody (CBMOAB-00212FYA)
CBMOAB-00360HCBMouse Anti-C. elegans ACT1 Antibody (CBMOAB-00360HCB)
CBMOAB-1576FYCMouse Anti-Arabidopsis ACT1 Antibody (CBMOAB-1576FYC)
MO-DKB-03913WMouse Anti-ACT1 Antibody (Cat MO-DKB-03913W)
MO-MMB-0317Rabbit Anti-ACT1 Antibody (Cat MO-MMB-0317)
MO-AB-28230WMouse Anti-Cucumber Act1 Antibody (MO-AB-28230W)
CBMOAB-00113CRMouse Anti-Yeast ACT1 Antibody (CBMOAB-00113CR)
CBMOAB-18478FYBMouse Anti-Rice ACT1 Antibody (CBMOAB-18478FYB)
MO-DKB-03697WRabbit Anti-ACT1 Antibody (Cat MO-DKB-03697W)
For Research Use Only | Not For Clinical Use.
Online Inquiry