AibGenesis™ Mouse Anti-Grape act1 Antibody (MO-AB-38815W)


Cat: MO-AB-38815W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-38815W Monoclonal Grape (Vitis vinifera), Alpaca (Vicugna pacos), Llama (camel), Cucumber (Cucumis sativus), Rice (Oryza), Yeast WB, ELISA MO38815W 100 µg
CBMOAB-00212FYA Monoclonal Alpaca (Vicugna pacos), Llama (camel) FC F00212FYA 100 µg
CBMOAB-00113CR Monoclonal Yeast WB, ELISA MO00113CR 100 µg
CBMOAB-18478FYB Monoclonal Rice (Oryza) WB, ELISA MO18478FYB 100 µg
MO-AB-28230W Monoclonal Cucumber (Cucumis sativus) WB, ELISA MO28230W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera), Alpaca (Vicugna pacos), Llama (camel), Cucumber (Cucumis sativus), Rice (Oryza), Yeast
CloneMO38815W
SpecificityThis antibody binds to Grape act1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionActins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Essential component of cell cytoskeleton; plays an important role in cytoplasmic streaming, cell shape determination, cell division, organelle movement and extension growth. This is considered as one of the reproductive actins. (From NCBI)
Product OverviewMouse Anti-Grape act1 Antibody is a mouse antibody against act1. It can be used for act1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesActin 1; act1
UniProt IDQ94KC1
Protein RefseqThe length of the protein is180 amino acids long.
The sequence is show below: TFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYMFTTTAEREIVRDMKEKLAYVALDYEQELETAKSSSSVEKNYELPDGQVITIGAERFRCPEVLFQPSLIG.
For Research Use Only | Not For Clinical Use.
Online Inquiry