Mouse Anti-Grape Lox Antibody (MO-AB-39189W)
Cat: MO-AB-39189W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-39189W | Monoclonal | WB, ELISA | MO39189W | 100 µg | |||
CBMOAB-00312FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ICC, IHC, FC | F00312FYA | 100 µg | ||
CBMOAB-23178FYA | Monoclonal | Fruit fly (Drosophila melanogaster) | WB, ELISA | MO23178FYA | 100 µg | ||
CBMOAB-49061FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO49061FYA | 100 µg | ||
CBMOAB-85245FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO85245FYA | 100 µg | ||
MO-AB-22562W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO22562W | 100 µg | ||
MO-AB-48572W | Monoclonal | Maize (Zea mays) | WB, ELISA | MO48572W | 100 µg | ||
MO-AB-15012R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO15012R | 100 µg | ||
MO-AB-27040R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27040R | 100 µg | ||
MO-AB-04883H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04883C | 100 µg | ||
MO-AB-34836H | Monoclonal | Tomato (Lycopersicon esculentum) | WB, ELISA | MO34836C | 100 µg | ||
MO-AB-11983Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11983Y | 100 µg | ||
MO-DKB-0315RA | Polyclonal | WB | 50 µL | ||||
MO-DKB-03272W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IF, IHC, IHC-P | 100 µg | |||
MO-DKB-03624W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, FC, IHC-P, IF | ms2109-032 | 100 µg | ||
MOFY-1222-FY114 | Polyclonal | Human, Mouse, Rat, Zebrafish | FC, IHC, ICC, WB | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Grape (Vitis vinifera), A. thaliana (Arabidopsis thaliana); Soybean (Glycine max (Linn.) Merr.); N. benthamiana (Nicotiana benthamiana); O. europaea (Olea europaea); Rice (Oryza), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Fruit fly (Drosophila melanogaster), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Frog (Xenopus), Zebrafish (Danio rerio), Human, Mouse, Rat, Zebrafish, Maize (Zea mays), O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Tomato (Lycopersicon esculentum) |
Clone | MO39189W |
Specificity | This antibody binds to Grape Lox. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme. |
Product Overview | Mouse Anti-Grape Lox Antibody is a mouse antibody against Lox. It can be used for Lox detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Lipoxygenase; Lox |
UniProt ID | Q6YCG7 |
Protein Refseq | The length of the protein is289 amino acids long. The sequence is show below: WGVVESTVFPSKYAMGMSSVVYKDWVLTEQALPADLIKRGVAVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQFWWKEVREEGHGDKKDEPWWPKMRTVKELIQTCTIIIWVASALHAAVDFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVHLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI. |
For Research Use Only | Not For Clinical Use.
Online Inquiry