Mouse Anti-Grape Lox Antibody (MO-AB-39189W)


Cat: MO-AB-39189W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO39189W
SpecificityThis antibody binds to Grape Lox.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the lysyl oxidase family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate a regulatory propeptide and the mature enzyme.
Product OverviewMouse Anti-Grape Lox (clone MO39189W) Antibody (MO-AB-39189W) is a mouse antibody against Lox. It can be used for Lox detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLipoxygenase; Lox
UniProt IDQ6YCG7
Protein RefseqThe length of the protein is289 amino acids long.
The sequence is show below: WGVVESTVFPSKYAMGMSSVVYKDWVLTEQALPADLIKRGVAVEDSEAPHGLRLLIDDYPYAVDGLEIWSAIETWVKEYCSFYYKTDEMVQKDSELQFWWKEVREEGHGDKKDEPWWPKMRTVKELIQTCTIIIWVASALHAAVDFGQYPYAGYLPNRPTISRRFMPEEGTPEYEELKSNPDKAFLKTITAQLQTLLGISLIEVLSRHSSDEVHLGQRDTPEWTLDTTPLKAFEKFGRKLADIEEMIIDRNGNERFKNRVGPVKIPYTLLYPTSEGGLTGKGIPNSVSI.
For Research Use Only | Not For Clinical Use.

Online Inquiry