Mouse Anti-Grape rbcL Antibody (MO-AB-39452W)


Cat: MO-AB-39452W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO39452W
SpecificityThis antibody binds to Grape rbcL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Introduction1,5-Diphosphate ribulose carboxylase/oxygenase is often referred to as RuBisCO, which is an enzyme involved in the first major step of carbon fixation. Through this process, plants convert atmospheric carbon dioxide into rich Energy molecules, such as glucose. In chemistry, it catalyzes the carboxylation of 1,5-diphosphate ribulose (also known as RuBP). It may be the most abundant enzyme on earth. This enzyme usually consists of two types of protein subunits, called the large chain (RbcL) and the small chain (RbcS).
Product OverviewMouse Anti-Grape rbcL Antibody is a mouse antibody against rbcL. It can be used for rbcL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibulose-1,5-bisphosphate carboxylase / oxygenase large subunit; rbcL
UniProt IDQ56V21
Protein RefseqThe length of the protein is51 amino acids long.
The sequence is show below: MSPQTETKASVGFKAGVKDYKLTYYTPEYETKPTDILAAFRVTPQPGVPPE.
See other products for " RbcL "
MO-DKB-01949WRabbit Anti-RbcL Antibody (MO-DKB-01949W)
MO-DKB-01625WRabbit Anti-RbcL Antibody (MO-DKB-01625W)
MOFAB-296WArabidopsis RBCL Antibody (MOFAB-296W)
MO-AB-00633HMouse Anti-Arabidopsis rbcL Antibody (MO-AB-00633H)
MO-DKB-01769WRabbit Anti-RbcL Antibody (MO-DKB-01769W)
CBMOAB-89031FYBMouse Anti-Rice rbcL Antibody (CBMOAB-89031FYB)
MO-AB-70559WMouse Anti-A. thaliana RbcL Antibody (MO-AB-70559W)
MO-MMB-0063Rabbit Anti-rbcL Antibody (Cat MO-MMB-0063)
MO-AB-30502HMouse Anti-Sugar beet rbcL Antibody (MO-AB-30502H)
MO-DKB-0447RARabbit Anti-RbcL Antibody (MO-DKB-0447RA)
For Research Use Only | Not For Clinical Use.
Online Inquiry