Mouse Anti-Grape rbcL Antibody (MO-AB-39452W)
Cat: MO-AB-39452W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Grape (Vitis vinifera) |
Clone | MO39452W |
Specificity | This antibody binds to Grape rbcL. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Chloroplast |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | 1,5-Diphosphate ribulose carboxylase/oxygenase is often referred to as RuBisCO, which is an enzyme involved in the first major step of carbon fixation. Through this process, plants convert atmospheric carbon dioxide into rich Energy molecules, such as glucose. In chemistry, it catalyzes the carboxylation of 1,5-diphosphate ribulose (also known as RuBP). It may be the most abundant enzyme on earth. This enzyme usually consists of two types of protein subunits, called the large chain (RbcL) and the small chain (RbcS). |
Product Overview | Mouse Anti-Grape rbcL Antibody is a mouse antibody against rbcL. It can be used for rbcL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Ribulose-1,5-bisphosphate carboxylase / oxygenase large subunit; rbcL |
UniProt ID | Q56V21 |
Protein Refseq | The length of the protein is51 amino acids long. The sequence is show below: MSPQTETKASVGFKAGVKDYKLTYYTPEYETKPTDILAAFRVTPQPGVPPE. |
See other products for " RbcL "
MO-DKB-01949W | Rabbit Anti-RbcL Antibody (MO-DKB-01949W) |
MO-DKB-01625W | Rabbit Anti-RbcL Antibody (MO-DKB-01625W) |
MOFAB-296W | Arabidopsis RBCL Antibody (MOFAB-296W) |
MO-AB-00633H | Mouse Anti-Arabidopsis rbcL Antibody (MO-AB-00633H) |
MO-DKB-01769W | Rabbit Anti-RbcL Antibody (MO-DKB-01769W) |
CBMOAB-89031FYB | Mouse Anti-Rice rbcL Antibody (CBMOAB-89031FYB) |
MO-AB-70559W | Mouse Anti-A. thaliana RbcL Antibody (MO-AB-70559W) |
MO-MMB-0063 | Rabbit Anti-rbcL Antibody (Cat MO-MMB-0063) |
MO-AB-30502H | Mouse Anti-Sugar beet rbcL Antibody (MO-AB-30502H) |
MO-DKB-0447RA | Rabbit Anti-RbcL Antibody (MO-DKB-0447RA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry