Mouse Anti-Grape rpl36 Antibody (MO-AB-39473W)
Cat: MO-AB-39473W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Grape (Vitis vinifera) |
| Clone | MO39473W |
| Specificity | This antibody binds to Grape rpl36. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L36E family of ribosomal proteins. It is located in the cytoplasm. Transcript variants derived from alternative splicing exist; they encode the same protein. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
| Product Overview | Mouse Anti-Grape rpl36 Antibody is a mouse antibody against rpl36. It can be used for rpl36 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Ribosomal protein; rpl36 |
| UniProt ID | B6VJY6 |
| Protein Refseq | The length of the protein is37 amino acids long. The sequence is show below: MKIRASVRKICEKCRLIRRRGRIIVICPNPRHKQRQG. |
See other products for " RPL36 "
| MO-AB-63531W | Mouse Anti-Marmoset RPL36 Antibody (MO-AB-63531W) |
| CBMOAB-40434FYC | Mouse Anti-Arabidopsis RPL36 Antibody (CBMOAB-40434FYC) |
| CBMOAB-30015FYA | Mouse Anti-D. melanogaster Rpl36 Antibody (CBMOAB-30015FYA) |
| MO-AB-12694W | Mouse Anti-Chimpanzee RPL36 Antibody (MO-AB-12694W) |
| MO-AB-00548W | Mouse Anti-Barrel medic rpl36 Antibody (MO-AB-00548W) |
| MO-AB-01513R | Mouse Anti-Medaka rpl36 Antibody (MO-AB-01513R) |
| CBMOAB-96440FYA | Mouse Anti-Zebrafish rpl36 Antibody (CBMOAB-96440FYA) |
| MO-AB-01919L | Mouse Anti-Bromus Rpl36 Antibody (MO-AB-01919L) |
| MO-AB-06848Y | Mouse Anti-O. anatinus RPL36 Antibody (MO-AB-06848Y) |
| MO-AB-09577W | Mouse Anti-Cat RPL36 Antibody (MO-AB-09577W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry