Mouse Anti-Grape rps14 Antibody (MO-AB-39482W)


Cat: MO-AB-39482W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO39482W
SpecificityThis antibody binds to Grape rps14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionRibosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S11P family of ribosomal proteins. It is located in the cytoplasm. Transcript variants utilizing alternative transcription initiation sites have been described in the literature. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. In Chinese hamster ovary cells, mutations in this gene can lead to resistance to emetine, a protein synthesis inhibitor. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.
Product OverviewMouse Anti-Grape rps14 Antibody is a mouse antibody against rps14. It can be used for rps14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibosomal protein S14; rps14
UniProt IDB6VJT6
Protein RefseqThe length of the protein is118 amino acids long.
The sequence is show below: MRLYHRGAAFFKKMRVSKMSEKLNIRDHKRRLLAAKYELRRKLYKAFCKDPDLPSDMRDKHRYKLSKLPRNSSFARVRNRCISTGRPRSVYEFFRISRIVFRGLASRGPLMGIKKSSW.
For Research Use Only | Not For Clinical Use.
Online Inquiry