Mouse Anti-Grape RRb1 Antibody (MO-AB-39495W)


Cat: MO-AB-39495W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-39495W Monoclonal Grape (Vitis vinifera), Yeast WB, ELISA MO39495W 100 µg
CBMOAB-00061CR Monoclonal Yeast WB, ELISA MO00061CR 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera), Yeast
CloneMO39495W
SpecificityThis antibody binds to Grape RRb1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionInvolved in regulation of L3 expression and stability and plays a role in early 60S ribosomal subunit assembly. May be required for proper assembly of pre-ribosomal particles during early ribosome biogenesis, presumably by targeting L3 onto the 35S precursor rRNA.
Product OverviewMouse Anti-Grape RRb1 Antibody is a mouse antibody against RRb1. It can be used for RRb1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytokinin B-type response regulator 1; RRb1
UniProt IDC3UZN3
Protein RefseqThe length of the protein is72 amino acids long.
The sequence is show below: YSNNSNSLQIKHPELYVLLDDDFSHALLSAPQHLLQVDLQCSANAVWSGTSVPERDKPGSVMIIPLCSQSRS.
For Research Use Only | Not For Clinical Use.
Online Inquiry