Mouse Anti-Grape RRb1 Antibody (MO-AB-39495W)
Cat: MO-AB-39495W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Grape (Vitis vinifera), Yeast |
| Clone | MO39495W |
| Specificity | This antibody binds to Grape RRb1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Involved in regulation of L3 expression and stability and plays a role in early 60S ribosomal subunit assembly. May be required for proper assembly of pre-ribosomal particles during early ribosome biogenesis, presumably by targeting L3 onto the 35S precursor rRNA. |
| Product Overview | Mouse Anti-Grape RRb1 Antibody is a mouse antibody against RRb1. It can be used for RRb1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cytokinin B-type response regulator 1; RRb1 |
| UniProt ID | C3UZN3 |
| Protein Refseq | The length of the protein is72 amino acids long. The sequence is show below: YSNNSNSLQIKHPELYVLLDDDFSHALLSAPQHLLQVDLQCSANAVWSGTSVPERDKPGSVMIIPLCSQSRS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry