Mouse Anti-GRHPR Antibody (CBMOAB-44116FYA)


Cat: CBMOAB-44116FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44116FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO44116FYA 100 µg
MO-AB-22839W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22839W 100 µg
MO-AB-56353W Monoclonal Marmoset WB, ELISA MO56353W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO44116FYA
SpecificityThis antibody binds to Rhesus GRHPR.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in this gene.
Product OverviewMouse Anti-Rhesus GRHPR Antibody is a mouse antibody against GRHPR. It can be used for GRHPR detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlyoxylate reductase/hydroxypyruvate reductase; GRHPR
UniProt IDI0FWH8
Protein RefseqThe length of the protein is 328 amino acids long.
The sequence is show below: MRPVLLMKVFVTRRIPPEGRAALARAADCEVEQWDSDEPIPVKELERGVAGAPGLLCLLSDRVDKRILDAAGANLKVISTLSVGVDHLALDEIKKRGIRVGYTPDVLTDATAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYGLTQSTVGIVGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATKGLCNKDFFQKMKETAVFVNISRGDVVNQDDLYQALASGQIAAAGLDVTTPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSMLAANNLLAGLRGEPMPSELML.
For Research Use Only | Not For Clinical Use.
Online Inquiry