AibGenesis™ Mouse Anti-GRTP1 Antibody (CBMOAB-44162FYA)


Cat: CBMOAB-44162FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44162FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO44162FYA 100 µg
MO-AB-13377R Monoclonal Cattle (Bos taurus) WB, ELISA MO13377R 100 µg
MO-AB-22214W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22214W 100 µg
MO-AB-56418W Monoclonal Marmoset WB, ELISA MO56418W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset
CloneMO44162FYA
SpecificityThis antibody binds to Rhesus GRTP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GRTP1 Antibody is a mouse antibody against GRTP1. It can be used for GRTP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGRTP1
UniProt IDF6Y0T1
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MDQNPGYYHRLLQGDRNPRLEDAIRTGSGTGPGGQKELVSTQCLVSVFSDSRVLLKDHSGIMQGMNFIAGYLILITNNEEESFWLLDALVGRILPDYYSPAMLGLKTDQEVLGELVRAKLPAVGALMERLGVLWTLVVSRWFICLFVDVLPVETVLRIWDCLFNEGSKIIFRVALTLIKQHQEFILEAASIPDICDKFKQITKGSFVMECHTFMQVSVCRAARGSVPQGAPPHLQPGGSSDHPEGAQDGHQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry