Mouse Anti-GSC Antibody (MO-AB-13379R)


Cat: MO-AB-13379R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-13379R Monoclonal Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO13379R 100 µg
CBMOAB-78792FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78792FYA 100 µg
MO-AB-21297W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21297W 100 µg
MO-AB-02235Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02235Y 100 µg
MO-AB-08268Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08268Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO13379R
SpecificityThis antibody binds to Cattle GSC.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the bicoid subfamily of the paired (PRD) homeobox family of proteins. The encoded protein acts as a transcription factor and may be autoregulatory. A similar protein in mice plays a role in craniofacial and rib cage development during embryogenesis.
Product OverviewMouse Anti-Cattle GSC Antibody is a mouse antibody against GSC. It can be used for GSC detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGoosecoid, Fragment; GSC
UniProt IDI3PWW6
Protein RefseqThe length of the protein is 251 amino acids long.
The sequence is show below: MFSIDNILATRPRCKDSVLPVAPSAATPVVFPALHGDSLYGGAGGGASSDYGAFYPRPVAPGGAGLPAAVGGSRLGYSNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSAVPHQMMPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSKASPEKREEEGKSDLDS.
See other products for " gsc "
For Research Use Only | Not For Clinical Use.
Online Inquiry