Mouse Anti-GSTM3 Antibody (CBMOAB-44207FYA)
Cat: CBMOAB-44207FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44207FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO44207FYA | 100 µg | ||
| CBMOAB-78839FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO78839FYA | 100 µg | ||
| MO-AB-13409R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13409R | 100 µg | ||
| MO-AB-23303W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23303W | 100 µg | ||
| MO-AB-26153H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26153C | 100 µg | ||
| MO-AB-56457W | Monoclonal | Marmoset | WB, ELISA | MO56457W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO44207FYA |
| Specificity | This antibody binds to Rhesus GSTM3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. Mutations of this class mu gene have been linked with a slight increase in a number of cancers, likely due to exposure with environmental toxins. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus GSTM3 Antibody is a mouse antibody against GSTM3. It can be used for GSTM3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | GSTM3 |
| UniProt ID | F7G540 |
| Protein Refseq | The length of the protein is 158 amino acids long. The sequence is show below: MDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDHEKLKPQYLEELPGQLKQFSVFLGKFSWFAGEKLTFVDFLTYDILDQNRIFEPKCLDEFPNLKAFMCRFEALEKIAAYIQSDQFFKMPINNKMAQWGNKPVC. |
For Research Use Only | Not For Clinical Use.
Online Inquiry