Mouse Anti-GSTM4 Antibody (CBMOAB-44209FYA)


Cat: CBMOAB-44209FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44209FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO44209FYA 100 µg
CBMOAB-60164FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60164FYC 100 µg
MO-AB-13410R Monoclonal Cattle (Bos taurus) WB, ELISA MO13410R 100 µg
MO-AB-24244W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO24244W 100 µg
MO-AB-26156H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26156C 100 µg
MO-AB-56464W Monoclonal Marmoset WB, ELISA MO56464W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO44209FYA
SpecificityThis antibody binds to Rhesus GSTM4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GSTM4 Antibody is a mouse antibody against GSTM4. It can be used for GSTM4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlutathione S-transferase Mu 5; GSTM4
UniProt IDH9EYA0
Protein RefseqThe length of the protein is 205 amino acids long.
The sequence is show below: MSMTLGYWDIRGLAHAIRLLLEYTDSNYEEKKYRMGHAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEEEKILVDILENQLMDSRMEMVRLCFDPNFEKLKPKYLEELPEKLKLYSQFLGKRPWFTGDKITFVDFLAYDVLDMRRIVEPGCLDAFPNLKDFISRFEGLKKISAYMKSSRFLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry