Mouse Anti-GTPBP10 Antibody (CBMOAB-44252FYA)


Cat: CBMOAB-44252FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44252FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO44252FYA 100 µg
CBMOAB-60175FYC Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO60175FYC 100 µg
CBMOAB-78919FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO78919FYA 100 µg
MO-AB-08273Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08273Y 100 µg
MO-AB-13436R Monoclonal Cattle (Bos taurus) WB, ELISA MO13436R 100 µg
MO-AB-26058W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26058W 100 µg
MO-AB-56508W Monoclonal Marmoset WB, ELISA MO56508W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO44252FYA
SpecificityThis antibody binds to Rhesus GTPBP10.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GTPBP10 Antibody is a mouse antibody against GTPBP10. It can be used for GTPBP10 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGTPBP10
UniProt IDF7GZX7
Protein RefseqThe length of the protein is 308 amino acids long.
The sequence is show below: MVHCGCVLFRKYGNFIDNLRLFTKGGSGGMGYPRLGGEGGKGGDVWVVARNRMTLKRLKDKYPQKRFVAGVGANSKFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYRDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQSKFHELMNQLQNPKDFLHLFGKNMTPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDAHHKKQLLNLWISDTVSSSEPPSKHAVTTSKMDII.
For Research Use Only | Not For Clinical Use.
Online Inquiry