Mouse Anti-Guinea pig ANXA4 Antibody (MO-AB-41241W)


Cat: MO-AB-41241W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41241W
SpecificityThis antibody binds to Guinea pig ANXA4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAnnexin IV (ANX4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANX4 has 45 to 59% identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANX4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANX4 is almost exclusively expressed in epithelial cells. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Guinea pig ANXA4 Antibody is a mouse antibody against ANXA4. It can be used for ANXA4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAnnexin; ANXA4
UniProt IDH0V9E1
Protein RefseqThe length of the protein is321 amino acids long.
The sequence is show below: CTQATKGGTVKAASGFNAIEDAQALRKAMKGLGTDEDAIIRVLAYRSTAQRQEIRTAYKTTIGRELIDDLKSELSGNFEQVIIGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIHRIKQTYQIQYGRSLEDDICSDTSFMFQRVLVSLSAGGRDQGNYLDDGLVKQDAKDLYDAGEKRWGTDEVKFLTILCSRNRNHLLHVFDEYKRISKKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAERLYKSMKGLGTDDSTLIRVMVSRAEIDMLDIRENFKRLYGKSLYSFIKGDTSGDYRKVLLALCGGDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry