Mouse Anti-Guinea pig Cln3 Antibody (MO-AB-41421W)


Cat: MO-AB-41421W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO41421W
SpecificityThis antibody binds to Guinea pig Cln3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationLysosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein that is involved in lysosomal function. Mutations in this, as well as other neuronal ceroid-lipofuscinosis (CLN) genes, cause neurodegenerative diseases commonly known as Batten disease or collectively known as neuronal ceroid lipofuscinoses (NCLs). Many alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Guinea pig Cln3 Antibody is a mouse antibody against Cln3. It can be used for Cln3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBattenin; Cln3
UniProt IDH0UYL8
Protein RefseqThe length of the protein is438 amino acids long.
The sequence is show below: MGCCAGSRRHLSDSEGEEAGPESRAPLLEHQGAEWKNAVGFWILGLCNNFSYVVMLSAAHDILRHEKASGNQSHVDPDPTATPHNSSSRFDCNSVSTAAVLLADILPTLVIKLLAPLGLHLLPYSPRVLVSGICSAGSFILVAFSHSVGTSLCGVVLASISSGLGEVTFLSLTAFYPRAVISWWSSGTGGAGLLGALSYLGLTQAGLSPQHTLLSMLGIPGLLLASYFLLLTSPKPQDPGEEDEAETAARQPLIGTEAPEPKPGTSWNLSLQERWTVFKGLLCHIIPLVLVYFAEYFINQGLFELLFFRNTSLSHAQQYRWYQMLYQAGVFVSRSSLRCCHIRFTWVLALLQCFNLAFLLVDVLLGFLPSIYFIFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGVVALPLHDFLCHLP.
See other products for " CLN3 "
MO-AB-29594WMouse Anti-Dog CLN3 Antibody (MO-AB-29594W)
CBMOAB-13628FYAMouse Anti-D. melanogaster Cln3 Antibody (CBMOAB-13628FYA)
MO-AB-17672WMouse Anti-Chimpanzee CLN3 Antibody (MO-AB-17672W)
CBMOAB-70779FYAMouse Anti-Zebrafish cln3 Antibody (CBMOAB-70779FYA)
MO-AB-14633YMouse Anti-Sheep CLN3 Antibody (MO-AB-14633Y)
CBMOAB-00753CRMouse Anti-Yeast CLN3 Antibody (CBMOAB-00753CR)
MO-AB-08460WMouse Anti-Cat CLN3 Antibody (MO-AB-08460W)
MO-AB-02476HMouse Anti-Frog cln3 Antibody (MO-AB-02476H)
MO-AB-06378YMouse Anti-O. anatinus CLN3 Antibody (MO-AB-06378Y)
MO-AB-10351RMouse Anti-Cattle CLN3 Antibody (MO-AB-10351R)
For Research Use Only | Not For Clinical Use.
Online Inquiry