Mouse Anti-Guinea pig MIP Antibody (MO-AB-42088W)


Cat: MO-AB-42088W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus)
CloneMO42088W
SpecificityThis antibody binds to Guinea pig MIP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMajor intrinsic protein is a member of the water-transporting aquaporins as well as the original member of the MIP family of channel proteins. The function of the fiber cell membrane protein encoded by this gene is undetermined, yet this protein is speculated to play a role in intracellular communication. The MIP protein is expressed in the ocular lens and is required for correct lens function. This gene has been mapped among aquaporins AQP2, AQP5, and AQP6, in a potential gene cluster at 12q13.
Product OverviewMouse Anti-Guinea pig MIP Antibody is a mouse antibody against MIP. It can be used for MIP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesLens fiber major intrinsic protein; Aquaporin-0; MIP; AQP0
UniProt IDQ6RZ07
Protein RefseqThe length of the protein is263 amino acids long.
The sequence is show below: MWELRSASFWRAIFAEFFATLFYVFFGLGASLRWAPGPLHVLQVALAFGLALAXLVQTVGHISGAHVNPAVTFXFLVGSQMSLLRAFCYMAAQLLGAVAGAAVLYSVTPPAVRGNLALNTLHAGVSVXQATTVEIFLTLQFVLCIFATYDERRNGRLGSVALAVGFSLTLGHLFGMYYTGAGMNPARSFAPAILTRNFTNHWVYWVGPIIGGGLGSLLYDFLLFPRLKSVSERLSILKGTRPSDNNGQPEGTGEPVELKTQAL.
For Research Use Only | Not For Clinical Use.
Online Inquiry