Mouse Anti-GYPA Antibody (CBMOAB-44300FYA)
Cat: CBMOAB-44300FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44300FYA | Monoclonal | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris) | WB, ELISA | MO44300FYA | 100 µg | ||
MO-AB-26701W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO26701W | 100 µg | ||
MO-AB-31053W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31053W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris) |
Clone | MO44300FYA |
Specificity | This antibody binds to Rhesus GYPA. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Glycophorins A (GYPA) and B (GYPB) are major sialoglycoproteins of the human erythrocyte membrane which bear the antigenic determinants for the MN and Ss blood groups. In addition to the M or N and S or s antigens that commonly occur in all populations, about 40 related variant phenotypes have been identified. These variants include all the variants of the Miltenberger complex and several isoforms of Sta, as well as Dantu, Sat, He, Mg, and deletion variants Ena, S-s-U- and Mk. Most of the variants are the result of gene recombinations between GYPA and GYPB. |
Product Overview | Mouse Anti-Rhesus GYPA Antibody is a mouse antibody against GYPA. It can be used for GYPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | GYPA |
UniProt ID | F6UAV1 |
Protein Refseq | The length of the protein is 67 amino acids long. The sequence is show below: ERVQLVHEFSELVIALIIFGVMAGVIGTILFISYCIRRLRKKSQSDVQPLPPPDAEVPLSSVEIENP. |
For Research Use Only | Not For Clinical Use.
Online Inquiry