AibGenesis™ Mouse Anti-GYPA Antibody (CBMOAB-44300FYA)


Cat: CBMOAB-44300FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44300FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris) WB, ELISA MO44300FYA 100 µg
MO-AB-26701W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26701W 100 µg
MO-AB-31053W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31053W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris)
CloneMO44300FYA
SpecificityThis antibody binds to Rhesus GYPA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus GYPA Antibody is a mouse antibody against GYPA. It can be used for GYPA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGYPA
UniProt IDF6UAV1
Protein RefseqThe length of the protein is 67 amino acids long.
The sequence is show below: ERVQLVHEFSELVIALIIFGVMAGVIGTILFISYCIRRLRKKSQSDVQPLPPPDAEVPLSSVEIENP.
For Research Use Only | Not For Clinical Use.
Online Inquiry