AibGenesis™ Mouse Anti-H2AFY2 Antibody (CBMOAB-44318FYA)


Cat: CBMOAB-44318FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44318FYA Monoclonal Rhesus (Macaca mulatta), Chicken (Gallus gallus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO44318FYA 100 µg
Inquiry
CBMOAB-79011FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79011FYA 100 µg
Inquiry
MO-AB-00600L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00600L 100 µg
Inquiry
MO-AB-02253Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02253Y 100 µg
Inquiry
MO-AB-04142H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04142C 100 µg
Inquiry
MO-AB-06546Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06546Y 100 µg
Inquiry
MO-AB-08287Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08287Y 100 µg
Inquiry
MO-AB-15608Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15608Y 100 µg
Inquiry
MO-AB-34872W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34872W 100 µg
Inquiry
MO-AB-56552W Monoclonal Marmoset WB, ELISA MO56552W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chicken (Gallus gallus), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Marmoset, O. anatinus (Ornithorhynchus anatinus), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO44318FYA
SpecificityThis antibody binds to Rhesus H2AFY2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and may participate in stable X chromosome inactivation. (From NCBI)
Product OverviewMouse Anti-Rhesus H2AFY2 Antibody is a mouse antibody against H2AFY2. It can be used for H2AFY2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; H2AFY2
UniProt IDH9FWT6
Protein RefseqThe length of the protein is 372 amino acids long.
The sequence is show below: MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRIIVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPGDGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIGIYVQEMAKLDTK.
For Research Use Only | Not For Clinical Use.
Online Inquiry