AibGenesis™ Mouse Anti-H2AJ Antibody (MO-AB-09082W)


Cat: MO-AB-09082W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09082W Monoclonal Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Rat (Rattus norvegicus) WB, ELISA MO09082W 100 µg
MO-AB-13483R Monoclonal Cattle (Bos taurus) WB, ELISA MO13483R 100 µg
MO-AB-23839W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23839W 100 µg
MO-AB-26217H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26217C 100 µg
MO-AB-31062W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31062W 100 µg
MO-AB-44987W Monoclonal Horse (Equus caballus) WB, ELISA MO44987W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Horse (Equus caballus), Rat (Rattus norvegicus)
CloneMO09082W
SpecificityThis antibody binds to Cat H2AJ.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Cat H2AJ Antibody is a mouse antibody against H2AJ. It can be used for H2AJ detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; H2AFJ
UniProt IDM3X2B2
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESQKAKSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry