AibGenesis™ Mouse Anti-H2BFWT Antibody (CBMOAB-44321FYA)


Cat: CBMOAB-44321FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44321FYA Monoclonal Rhesus (Macaca mulatta), Marmoset WB, ELISA MO44321FYA 100 µg
MO-AB-56554W Monoclonal Marmoset WB, ELISA MO56554W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Marmoset
CloneMO44321FYA
SpecificityThis antibody binds to Rhesus H2BFWT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a replication-independent histone that is a member of the H2B histone family that is specifically expressed in sperm nuclei. A polymorphism in the 5' UTR of this gene is associated with male infertility. (From NCBI)
Product OverviewMouse Anti-Rhesus H2BFWT Antibody is a mouse antibody against H2BFWT. It can be used for H2BFWT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesH2BFWT
UniProt IDF6U4G8
Protein RefseqThe length of the protein is 175 amino acids long.
The sequence is show below: MLRTQVPPLLRSTTAIVWSCRVMAAASAMAEPSSETTSEEQLITQEPKEANSTMAQKQSKQRKRGRRGPCRCHANCRGDSFATYFRRVLKQVHQGLSLSREAVSVMDSLVHDILDRIATEAGRLARSTKRQTITAWETRIAVRLLLPGEMGKLAESEGTKAVLRTSLYAVQQQRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry